PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0101s0068.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 437aa    MW: 46267.6 Da    PI: 8.732
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0101s0068.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.83.2e-30250303155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Mapoly0101s0068.1.p 250 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 303
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.927247306IPR017930Myb domain
SuperFamilySSF466891.08E-19247307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-30249308IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-24251303IPR006447Myb domain, plants
PfamPF002492.7E-7253302IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MAAMKDDNNR VREWEAGLPS ASDLTPLHHS LITRVLARAF CIPTNATPPS AADVLQASKS  60
TVQQLQQKKN TAFTLPAFET YPCYESRTGA RAAAAGAANG GGGAYATEES MDDERGGYDL  120
TKRSKDDSGR RSSRVTKSPM HGSKGGWDGD KASERDVGVS GSGIGGVGNG NSGPDFGPAY  180
YWPAQGSMPG GPGPYGPMGS DQGGYGGMEG GSESTKGASL EKSRKLGDTE SEDVDSADCP  240
DGNTARTLKR PRLVWTPQLH KRFVDAVGHL GIKNAVPKTI MQLMNVEGLT RENVASHLQK  300
YRLYLKRMQG LSNEGPSASD PLFASAPLPP NLTQSPHFFT NHPHLRAENG VSGPSFSPPA  360
VPMPRAQQAI PPGVMGPGVM GPGAVQHFGG FEHHPYSIGL ARSAAQQRPP MGEHREFMAE  420
FEGRARVMRN GLQFAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-21249308463ARR10-B
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.25e-51G2-like family protein